PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009596681.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 638aa    MW: 69977 Da    PI: 4.5841
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009596681.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1631.1e-50271551128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lp+G+rF+Ptdeelv++yL+ k++g + ++  vi+evdi+k+eP+dLp  + v++++++w+fF++ d+ky++g+r nrat++gyWkatgkd++++
  XP_009596681.1  27 LPVGYRFRPTDEELVNHYLRLKINGCDDKV-GVIREVDICKFEPSDLPdlSVVESKDNDWFFFCPIDRKYQNGQRLNRATERGYWKATGKDRNIV 120
                     799************************999.99**************96448888999************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +kkg+++g+kktLv+y grap+g++t+Wv+heyr+
  XP_009596681.1 121 TKKGAKIGMKKTLVYYIGRAPEGKRTNWVIHEYRA 155
                     *********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.41E-5723178IPR003441NAC domain
PROSITE profilePS5100553.13927178IPR003441NAC domain
PfamPF023653.5E-2628154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009814Biological Processdefense response, incompatible interaction
GO:0010200Biological Processresponse to chitin
GO:0070417Biological Processcellular response to cold
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MAVIAGDNAI AVLPGGKQLE VPPLNTLPVG YRFRPTDEEL VNHYLRLKIN GCDDKVGVIR  60
EVDICKFEPS DLPDLSVVES KDNDWFFFCP IDRKYQNGQR LNRATERGYW KATGKDRNIV  120
TKKGAKIGMK KTLVYYIGRA PEGKRTNWVI HEYRATDKSL DGSHPGQGAF VLCRLFKKNE  180
LKQDENVESS HLDEVQQLVS SPAVGKSPGN EISDAVAPSP IMESDSDKSN PPKISGGETH  240
GTRLPIDSRG DSCTVDDTED QMLDITSVPS DPELEKLLEI FCDTSPQPLD WKICSPLHAQ  300
LQVEFGSSYV HAPVINEMSH DQKDVQFQNG TNAFDINEFF NSVLDSSDEL SYEDSGLELR  360
TVQFASNTIN TITRSPFKDS GLCSESKAQV TQEPVGTDLF EPKETALMRE VNPVATTVEE  420
AFATPYVSND HSVANLDFLN NGYPGDAALS AGSGGMQVPN VLNVEDSSSY RTGSSDSGFG  480
TGIKLRTRLK QNQPDDEQFG SGMQGTSHRR IRFQVKRRAG RAECDVPTDS DMGGENPEEL  540
LTVSESEKFS IEDSSTAGAA ICGDKTQDTM CKEFKGYGRV AEDLSANAKD AYDFPVDEAS  600
KMAALSSFSS SFYISKALVA VSVIVVFLGF LGICFKLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-43201838170NO APICAL MERISTEM PROTEIN
1ut4_B8e-43201838170NO APICAL MERISTEM PROTEIN
1ut7_A8e-43201838170NO APICAL MERISTEM PROTEIN
1ut7_B8e-43201838170NO APICAL MERISTEM PROTEIN
3swm_A9e-432018311173NAC domain-containing protein 19
3swm_B9e-432018311173NAC domain-containing protein 19
3swm_C9e-432018311173NAC domain-containing protein 19
3swm_D9e-432018311173NAC domain-containing protein 19
3swp_A9e-432018311173NAC domain-containing protein 19
3swp_B9e-432018311173NAC domain-containing protein 19
3swp_C9e-432018311173NAC domain-containing protein 19
3swp_D9e-432018311173NAC domain-containing protein 19
4dul_A8e-43201838170NAC domain-containing protein 19
4dul_B8e-43201838170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00398DAPTransfer from AT3G49530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009596681.10.0PREDICTED: NAC domain-containing protein 74-like
TrEMBLM1CKK60.0M1CKK6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000695110.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33632448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49530.19e-85NAC domain containing protein 62